PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.1276s0003.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family G2-like
Protein Properties Length: 473aa    MW: 51320.6 Da    PI: 5.9434
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.1276s0003.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like103.11.7e-32255309155
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          k+r+rWtpeLHe+Fv+av++LGGse+AtPk +l+ m+++gLt++hvkSHLQkYR+
  Kalax.1276s0003.1.p 255 KARMRWTPELHEAFVQAVASLGGSERATPKGVLKRMNIEGLTIYHVKSHLQKYRT 309
                          68****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.433252312IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.8E-29255310IPR009057Homeodomain-like
SuperFamilySSF466894.3E-16255309IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-23255309IPR006447Myb domain, plants
PfamPF002494.7E-10257308IPR001005SANT/Myb domain
PfamPF143793.4E-25342388IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 473 aa     Download sequence    Send to blast
MEARPIPIYN SGGKQHSGAC GAISSSLSVL PSHLDHNSPN FQDHQQASLR KGVMGGGSFM  60
RASPFISNNG MVGPLHSSSS GFSTDIQFSN VSPCSRNTST ISQSSINVTP FPPTHSSFSG  120
VLQSTASSQI NSANNISWCT DPQQEFFDFA SPGNHIQTGR KGSSAVMPTD DLGKQSDWQE  180
WADQLITSEE ALNANWNEYI CDVALENMDG ETGCIKKPSS DVQRQQPQVQ LQPTAPSSET  240
GNAGTPTSSA NGAVKARMRW TPELHEAFVQ AVASLGGSER ATPKGVLKRM NIEGLTIYHV  300
KSHLQKYRTA RFRPDPSEAG SSDKRSTSIE EISSLDLKSG IDITEALRLQ MEVQKRLHEQ  360
LEVQRNLQLR IEEQGRYLQQ MFEQQCKSMP DSVKAAMTPD GQQHSSDKLG VQEVSPNDNK  420
NPGSENADSS TSLGENPCNQ VILPAKSSRE VDDIDMSQPS KRKKTGEPSE PN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002270511.11e-141PREDICTED: protein PHR1-LIKE 1
SwissprotQ8GUN51e-80PHL1_ARATH; Protein PHR1-LIKE 1
TrEMBLF6HZP91e-141F6HZP9_VITVI; Putative uncharacterized protein
STRINGVIT_07s0005g04120.t011e-141(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28610.15e-89phosphate starvation response 1